RHOQ/TC10 Monoclonal antibody, PBS Only

• 

  WB analysis using 67213-1-Ig (same clone as 67213-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67213-1-Ig (RHOQ/TC10 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67213-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 67213-1-Ig (same clone as 67213-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67213-1-Ig (RHOQ/TC10 antibody) at dilution of 1:16000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67213-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 67213-1-Ig (same clone as 67213-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67213-1-Ig (RHOQ/TC10 antibody) at dilution of 1:16000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67213-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67213-1-Ig (same clone as 67213-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67213-1-Ig (RHOQ/TC10 antibody) at dilution of 1:16000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67213-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67213-1-Ig (same clone as 67213-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67213-1-Ig (RHOQ/TC10 antibody) at dilution of 1:16000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67213-1-PBS in a different storage buffer formulation.

RHOQ/TC10 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67213-1-PBS

Clone No.3B9C7

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

ARHQ, Ras like protein TC10, RASL7A, RHOQ, RHOQ/TC10, TC10, TC10A

---

Product Information

67213-1-PBS targets RHOQ/TC10 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, mouse, rat, pig samples.

• Tested Reactivity: Human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12078

  Product name: Recombinant human RHOQ protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-205 aa of BC070485

  Sequence: MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT

• Full Name: ras homolog gene family, member Q
• Calculated Molecular Weight: 205 aa, 23 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC070485
• Gene Symbol: RHOQ/TC10
• Gene ID (NCBI): 23433
• RRID: AB_2882505
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17081
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.