Tested Applications
| Positive WB detected in | HEK-293T cells, human kidney tissue, mouse heart tissue, L02 cells, HepG2 cells, human testis tissue, human heart tissue, K-562 cells, Hela cells |
| Positive IP detected in | L02 cells |
| Positive IHC detected in | human colon tissue, human kidney tissue, human heart tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11237-1-AP targets MIRO2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1752 Product name: Recombinant human RHOT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 319-618 aa of BC014942 Sequence: DRDGALSPVELQSLFSVFPAAPWGPELPRTVRTEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSFWLRGLLGVVGAAVAAVLSFSLYRVLVKSQ Predict reactive species |
| Full Name | ras homolog gene family, member T2 |
| Calculated Molecular Weight | 68 kDa |
| Observed Molecular Weight | 68-80 kDa |
| GenBank Accession Number | BC014942 |
| Gene Symbol | RHOT2 |
| Gene ID (NCBI) | 89941 |
| RRID | AB_2179539 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IXI1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RHOT2 (Ras homolog gene family, member T2), also known as ARHT2, RASL or MIRO-2 (mitochondrial Rho GTPase 2), is a 618 amino acid single-pass type IV membrane protein as a member of the Rho family of GTPases. It is localized to the outer mitochondrial membrane and plays a role in mitochondrial trafficking and fusion-fission dynamics. RHOT2 is ubiquitously expressed with highest levels found in pancreas, heart, kidney and skeletal muscle. MIRO2 is highly phosphorylated at basal conditions, as evidenced by an immunoreactive band that electrophoretically migrates 7 kDa higher (~75 kDa) compared to its predicted molecular weight (68 kDa) (PMID: 28556983).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MIRO2 antibody 11237-1-AP | Download protocol |
| IHC protocol for MIRO2 antibody 11237-1-AP | Download protocol |
| IP protocol for MIRO2 antibody 11237-1-AP | Download protocol |
| WB protocol for MIRO2 antibody 11237-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MIRO2 Polyclonal antibody (Cat# 11237-1-AP) has 32 citations spanning 25 journals, including Cell, Nature Cell Biology, Nature Communications, Neuron, EMBO Journal, Science Advances, and eLife. Research fields covered include mitochondrial dynamics (fusion/fission), mitochondrial trafficking, mitophagy, neurodegeneration (Alzheimer's, Huntington's disease), cancer metastasis, ischemic stroke, oxidative stress, and mitochondrial quality control. Applications cited include WB, IF, IP, CoIP, and IHC across human, mouse, rat, and monkey species.
| Species | Application | Title |
|---|---|---|
Cell Mis-splicing-derived neoantigens and cognate TCRs in splicing factor mutant leukemias | ||
Nat Cell Biol MIROs and DRP1 drive mitochondrial-derived vesicle biogenesis and promote quality control.
| ||
Protein Cell Hypertonia-linked protein Trak1 functions with mitofusins to promote mitochondrial tethering and fusion. | ||
Nat Commun Mitochondrial components secretion in extracellular vesicles promotes alveolar epithelial mitochondrial quality control. | ||
Nat Commun The cholesterol transport protein GRAMD1C regulates autophagy initiation and mitochondrial bioenergetics | ||
Neuron Brain-derived autophagosome profiling reveals the engulfment of nucleoid-enriched mitochondrial fragments by basal autophagy in neurons. |
Reviews
What customers say
Both reviewers gave 5-star ratings. One user reported excellent results with immunofluorescence, stating it "worked very well so far." The other tested the antibody on HeLa total cell lysate by Western Blot at a 1:1000 dilution and described the performance as "very good." Overall, users are satisfied with the antibody's performance across different applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mary (Verified Customer) (09-09-2024) | Worked very well so far!!
|
Tim (Verified Customer) (11-25-2021) | Tested on HeLa total cell lysate. Very good.
 |
