RHOXF2 Polyclonal antibody

• 

  WB analysis of K-562 using 13088-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 13088-1-AP (RHOXF2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 13088-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 13088-1-AP (RHOXF2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

RHOXF2 Polyclonal Antibody for WB, ELISA

Cat No. 13088-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, IHC, ELISA

Synonyms

PEPP 2, PEPP2, Rhox homeobox family member 2, Rhox homeobox family, member 2, RHOXF2, Testis homeobox gene 1, THG1

---

Tested Applications

• Positive WB detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

13088-1-AP targets RHOXF2 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3602

  Product name: Recombinant human RHOXF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-288 aa of BC021719

  Sequence: MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHAFTPLQLQELERIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQRALMARNMLPFMAVGQPVMVTAAEAITAPLFISGMRDDYFWDHSHSSSLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIVPSFTFPNV

• Full Name: Rhox homeobox family, member 2
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC021719
• Gene Symbol: RHOXF2
• Gene ID (NCBI): 84528
• RRID: AB_2179677
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQY4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF	Hum Mol Genet; The human RHOX gene cluster: target genes and functional analysis of gene variants in infertile men.; Authors - Jennifer Borgmann