RIC3 Polyclonal antibody

• 

  WB analysis of mouse heart using 27776-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 27776-1-AP (RIC3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

RIC3 Polyclonal Antibody for WB, ELISA

Cat No. 27776-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

AYST720, PRO1385, Protein RIC 3, RIC3

---

Tested Applications

• Positive WB detected in: mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

27776-1-AP targets RIC3 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26740

  Product name: Recombinant human RIC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 117-369 aa of BC022455

  Sequence: KLSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLFNRVGPNGERAQTVTSDQEKRLLHQLREITRVMKEGKFIDRFSPEKEAEEAPYMEDWEGYPEETYPIYDLSDCIKRRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWESLPTDPRAQEDNSVTSCDPKPETCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGISTDKAYTGSMLRKRNPQGLE

• Full Name: resistance to inhibitors of cholinesterase 3 homolog (C. elegans)
• Calculated Molecular Weight: 368 aa, 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC022455
• Gene Symbol: RIC3
• Gene ID (NCBI): 79608
• RRID: AB_2880969
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z5B4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Toxics; Nicotine Causes Nephrotoxicity through the Induction of NLRP6 Inflammasome and Alpha7 Nicotinic Acetylcholine Receptor.; Authors - Cai-Mei Zheng
human	WB	BMC Cancer; Radioresistance-related gene signatures identified by transcriptomics characterize the prognosis and immune landscape of pancreatic cancer patients; Authors - Dandan Wang