RIG-1/DDX58 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of A431 using 84861-5-RR (same clone as 84861-5-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 84861-5-RR (RIG-1/DDX58 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84861-5-PBS in a different storage buffer formulation.

• 

  WB analysis using 84861-5-RR (same clone as 84861-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84861-5-RR (RIG-1/DDX58 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84861-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 84861-5-RR (same clone as 84861-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 84861-5-RR (RIG-1/DDX58 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84861-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 84861-5-RR (same clone as 84861-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 84861-5-RR (RIG-1/DDX58 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84861-5-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 84861-5-RR (same clone as 84861-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using RIG-1/DDX58 antibody (84861-5-RR, Clone: 242424E7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84861-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84861-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84861-5-RR against Human RIG-1/DDX58 were performed. The affinity constant is below 1 pM.

RIG-1/DDX58 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84861-5-PBS

Clone No.242424E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

DDX58, RIG-I, 242424E7, Antiviral innate immune response receptor RIG-I, ATP-dependent RNA helicase DDX58

---

Product Information

84861-5-PBS targets RIG-1/DDX58 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18585

  Product name: Recombinant human DDX58 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 575-925 aa of BC132786

  Sequence: RAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 58
• Calculated Molecular Weight: 925 aa, 106 kDa
• Observed Molecular Weight: 101~106 kDa
• GenBank Accession Number: BC132786
• Gene Symbol: RIG-1/DDX58
• Gene ID (NCBI): 23586
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O95786
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DDX58, also named as RIG-1, belongs to the helicase family. It is involved in innate immune defense against viruses. Upon interaction with intracellular dsRNA produced during viral replication, triggers a transduction cascade involving MAVS/IPS1, which results in the activation of NF-kappa-B, IRF3 and IRF7 and the induction of the expression of antiviral cytokines such as IFN-beta and RANTES (CCL5). Detects dsRNA produced from non-self dsDNA by RNA polymerase III, such as Epstein-Barr virus-encoded RNAs (EBERs). It is essential for the production of interferons in response to RNA viruses including paramyxoviruses, influenza viruses, Japanese encephalitis virus and HCV. The antibody is specific to DDX58.