CoraLite® Plus 488-conjugated RIG-1/DDX58 Monoclonal antibody

RIG-1/DDX58 Monoclonal Antibody for
Cat No. CL488-67556
Clone No.3B10F5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

DDX58, RIG-I, 3B10F5, Antiviral innate immune response receptor RIG-I, ATP-dependent RNA helicase DDX58

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-67556 targets RIG-1/DDX58 in applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18591

Product name: Recombinant human DDX58 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 575-925 aa of BC132786

Sequence: RAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 58
Calculated Molecular Weight 925 aa, 106 kDa
Observed Molecular Weight 101/106 kDa
GenBank Accession NumberBC132786
Gene Symbol RIG-1/DDX58
Gene ID (NCBI) 23586
RRIDAB_2919499
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO95786
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DDX58, also named as RIG-1, belongs to the helicase family. It is involved in innate immune defense against viruses. Upon interaction with intracellular dsRNA produced during viral replication, triggers a transduction cascade involving MAVS/IPS1, which results in the activation of NF-kappa-B, IRF3 and IRF7 and the induction of the expression of antiviral cytokines such as IFN-beta and RANTES (CCL5). Detects dsRNA produced from non-self dsDNA by RNA polymerase III, such as Epstein-Barr virus-encoded RNAs (EBERs). It is essential for the production of interferons in response to RNA viruses including paramyxoviruses, influenza viruses, Japanese encephalitis virus and HCV. The antibody is specific to DDX58,which has two isoform with the MW of 106 and 101 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...