RILPL2 Polyclonal antibody

• 

  WB analysis using 15955-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15955-1-AP (RILPL2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

RILPL2 Polyclonal Antibody for WB, ELISA

Cat No. 15955-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

p40phox binding protein, RILP like protein 2, RILPL2, RLP2

---

Tested Applications

• Positive WB detected in: HL-60 cells, THP-1 cells, U-937 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below

Product Information

15955-1-AP targets RILPL2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8704

  Product name: Recombinant human RILPL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-211 aa of BC013042

  Sequence: MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVRVLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRDVLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKDAVVTSAKNAGRNKEEKTIIKKLFFFRSGKQT

• Full Name: Rab interacting lysosomal protein-like 2
• Calculated Molecular Weight: 211 aa, 24 kDa
• Observed Molecular Weight: 24-28 kDa
• GenBank Accession Number: BC013042
• Gene Symbol: RILPL2
• Gene ID (NCBI): 196383
• RRID: AB_2923561
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q969X0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Sci Transl Med; Melanocortin-1 receptor activation is neuroprotective in mouse models of neuroinflammatory disease.; Authors - Nadine Mykicki
mouse	WB	Cell Rep; Exercise training and cold exposure trigger distinct molecular adaptations to inguinal white adipose tissue; Authors - Maria Vamvini
mouse	WB	bioRxiv; Exercise Training and Cold Exposure Trigger Distinct Molecular Adaptations to Inguinal White Adipose Tissue; Authors - Maria Vamvini