RILPL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RILPL2 Polyclonal antibody (15955-1-AP)

RILPL2 Polyclonal Antibody for WB, ELISA

Cat No. 15955-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

p40phox binding protein, RILP like protein 2, RILPL2, RLP2

• 

  WB analysis using 15955-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15955-1-AP (RILPL2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RILPL2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells, THP-1 cells, U-937 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15955-1-AP targets RILPL2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8704

  Product name: Recombinant human RILPL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-211 aa of BC013042

  Sequence: MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVRVLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRDVLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKDAVVTSAKNAGRNKEEKTIIKKLFFFRSGKQT

• Full Name: Rab interacting lysosomal protein-like 2
• Calculated Molecular Weight: 211 aa, 24 kDa
• Observed Molecular Weight: 24-28 kDa
• GenBank Accession Number: BC013042
• Gene Symbol: RILPL2
• Gene ID (NCBI): 196383
• RRID: AB_2923561
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q969X0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RILPL2 Polyclonal antibody (Cat# 15955-1-AP) has 3 total citations. These appear in Science Translational Medicine, Cell Reports, and bioRxiv. The research fields span neuroinflammation and neuroprotection (melanocortin-1 receptor signaling in mouse models) and adipose tissue biology (molecular adaptations of inguinal white adipose tissue to exercise training and cold exposure). All cited studies used mouse samples with WB or IF applications.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Sci Transl Med; Melanocortin-1 receptor activation is neuroprotective in mouse models of neuroinflammatory disease.; Authors - Nadine Mykicki
mouse	WB	Cell Rep; Exercise training and cold exposure trigger distinct molecular adaptations to inguinal white adipose tissue; Authors - Maria Vamvini
mouse	WB	bioRxiv; Exercise Training and Cold Exposure Trigger Distinct Molecular Adaptations to Inguinal White Adipose Tissue; Authors - Maria Vamvini