RIOK2 Polyclonal antibody

• 

  WB analysis using 17410-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17410-1-AP (RIOK2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse ovary using 17410-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 17410-1-AP (RIOK2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 17410-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17410-1-AP (RIOK2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 17410-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17410-1-AP (RIOK2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 17410-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using RIOK2 antibody (17410-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

RIOK2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 17410-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:2.7.11.1, RIO kinase 2, RIO2, Serine/threonine-protein kinase RIO2

---

Tested Applications

• Positive WB detected in: Caco-2 cells, HCT 116 cells
• Positive IHC detected in: mouse brain tissue, mouse ovary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17410-1-AP targets RIOK2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9975

  Product name: Recombinant human RIOK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 249-553 aa of BC000953

  Sequence: QMVSTSHPNAEWYFDRDVKCIKDFFMKRFSYESELFPTFKDIRREDTLDVEVSASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYGSENESERNCLEESEGCYCRSSGDPEQIKEDSLSEESADARSFEMTEFNQALEEIKGQVVENNSVTEFSEEKNRTENYNRQDGQRVQGGVPAGSDEYEDECPHLIALSSLNREFRPFRDEENVGAMNQYRTRTLSITSSGSAVSCSTIPPELVKQKVKRQLTKQQKSAVRRRLQKGEANIFTKQRRENMQNIKSSLEAASFWGE

• Full Name: RIO kinase 2 (yeast)
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC000953
• Gene Symbol: RIOK2
• Gene ID (NCBI): 55781
• RRID: AB_2178093
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BVS4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rio-kinase 2 (RIOK2) is an atypical serine-threonine kinase that participates in the nuclear export and maturation steps of the pre-40S ribosomal complex to facilitate cytoplasmic translation. RIOK2 binds the pre-40S subunit and promotes its nuclear export by interaction with the CRM1 chaperone protein (PMID: 36661680, 28499923).