RIPK1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RIPK1 Polyclonal antibody (29932-1-AP)

RIPK1 Polyclonal Antibody for WB, ELISA

Cat No. 29932-1-AP

Publications(28)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, ELISA

Synonyms

EC:2.7.11.1, Receptor interacting serine/threonine protein kinase 1, Receptor-interacting protein 1, Receptor-interacting serine/threonine-protein kinase 1, RIP

• 

  WB analysis using 29932-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29932-1-AP (RIPK1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 29932-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29932-1-AP (RIPK1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: K-562 cells, HepG2 cells, L02 cells, MCF-7 cells, MDA-MB-231 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29932-1-AP targets RIPK1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, pig, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31950

  Product name: Recombinant human RIPK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 465-671 aa of NM_003804

  Sequence: NNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN

• Full Name: receptor (TNFRSF)-interacting serine-threonine kinase 1
• Calculated Molecular Weight: 76KD
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: NM_003804
• Gene Symbol: RIPK1
• Gene ID (NCBI): 8737
• RRID: AB_3086193
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13546
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RIPK1(Receptor-interacting serine/threonine-protein kinase 1) is primarily involved in mediating TNF-R1-induced cell activation, apoptosis, and necroptosis and belongs to a novel class of kinases that function in cell survival and cell death mechanisms(PMID:22685397 ). It has 2 isoforms produced by alternative splicing. It also can exist as a protein with a lower molecular weight of about 25 kDa and 45 kDa in HAEC and HUVEC(PMID:22685397).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; Systematic discovery of pathogen effector functions across human pathogens and pathways.; Authors - Tomas Pachano
chicken	WB	J Adv Res; PERK drives aflatoxin B1-induced chicken cellular senescence by promoting NLRP3-mediated PANoptosis.; Authors - Yue Cheng
human	WB	Theranostics; Oxidative stress-mediated PANoptosis and ferroptosis: Exploration of multimodal cell death triggered by an AIE-active nano-photosensitizer via photodynamic therapy.; Authors - Yuqing Wang
	WB	Theranostics; Microvascular endothelial metabolic dysfunction drives cerebral edema through bioenergetic failure after ischemia-reperfusion.; Authors - Yi-Fan Zhou
pig	WB	Microbiome; Faecalibacterium prausnitzii-derived outer membrane vesicles reprogram gut microbiota metabolism to alleviate Porcine Epidemic Diarrhea Virus infection; Authors - JunHong Xing
	WB	Adv Sci (Weinh); RIPK1 Drives JAK1-STAT3 Signaling to Promote CXCL1-Mediated Neutrophil Recruitment in Sepsis-Induced Lung Injury.; Authors - Hao Sun ; KO Validated