RIPK1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84036-6-RR (same clone as 84036-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84036-6-RR (RIPK1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84036-6-PBS in a different storage buffer formulation.

RIPK1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84036-6-PBS

Clone No.251185E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:2.7.11.1, Receptor interacting serine/threonine protein kinase 1, Receptor-interacting protein 1, Receptor-interacting serine/threonine-protein kinase 1, RIP

---

Product Information

84036-6-PBS targets RIPK1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag31950

  Product name: Recombinant human RIPK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 465-671 aa of NM_003804

  Sequence: NNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN

• Full Name: receptor (TNFRSF)-interacting serine-threonine kinase 1
• Calculated Molecular Weight: 76KD
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: NM_003804
• Gene Symbol: RIPK1
• Gene ID (NCBI): 8737
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13546
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RIPK1(Receptor-interacting serine/threonine-protein kinase 1) is primarily involved in mediating TNF-R1-induced cell activation, apoptosis, and necroptosis and belongs to a novel class of kinases that function in cell survival and cell death mechanisms(PMID:22685397 ). It has 2 isoforms produced by alternative splicing. It also can exist as a protein with a lower molecular weight of about 25 kDa and 45 kDa in HAEC and HUVEC(PMID:22685397).