RLN1 Polyclonal antibody

• 

  IHC staining of human testis using 23852-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23852-1-AP (RLN1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human testis using 23852-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23852-1-AP (RLN1 antibody) at dilution of 1:200 (under 40x lens).

RLN1 Polyclonal Antibody for ELISA

Cat No. 23852-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

H1, Prorelaxin H1, relaxin 1, RLN1, RLXH1

---

Product Information

23852-1-AP targets RLN1 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20880

  Product name: Recombinant human RLN1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-185 aa of BC005956

  Sequence: MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC

• Full Name: relaxin 1
• Calculated Molecular Weight: 185 aa, 21 kDa
• GenBank Accession Number: BC005956
• Gene Symbol: RLN1
• Gene ID (NCBI): 6013
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P04808
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.