RNASE13 Polyclonal antibody

• 

  WB analysis of mouse liver using 18408-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 18408-1-AP (RNASE13 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 18408-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 18408-1-AP (RNASE13 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 18408-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 18408-1-AP (RNASE13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

RNASE13 Polyclonal Antibody for WB, ELISA

Cat No. 18408-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Ribonuclease like protein 13, RNASE13

---

Tested Applications

• Positive WB detected in: mouse liver tissue, mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18408-1-AP targets RNASE13 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12320

  Product name: Recombinant human RNASE13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-156 aa of BC044831

  Sequence: MAPAVTRLLFLQLVLGPTLVMDIKMQIGSRNFYTLSIDYPRVNYPKGFRGYCNGLMSYMRGKMQNSDCPKIHYVIHAPWKAIQKFCKYSDSFCENYNEYCTLTQDSLPITVCSLSHQQPPTSCYYNSTLTNQKLYLLCSRKYEADPIGIAGLYSGI

• Full Name: ribonuclease, RNase A family, 13 (non-active)
• Calculated Molecular Weight: 156 aa, 18 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC044831
• Gene Symbol: RNASE13
• Gene ID (NCBI): 440163
• RRID: AB_10598316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5GAN3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.