Use Able AI chat for product recommendations

RNASET2 Recombinant monoclonal antibody, PBS Only (Detector)

RNASET2 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83650-1-PBS
Clone No.240581C4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

RNase T2, RNASE6PL, Ribonuclease T2, Ribonuclease 6, EC:4.6.1.19

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83650-1-PBS targets RNASET2 as part of a matched antibody pair:

MP00620-1: 83650-2-PBS capture and 83650-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28353

Product name: Recombinant human RNASET2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 25-256 aa of BC039713

Sequence: DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH

Predict reactive species
Full Name ribonuclease T2
Calculated Molecular Weight 256 aa, 29 kDa
GenBank Accession NumberBC039713
Gene Symbol RNase T2
Gene ID (NCBI) 8635
RRIDAB_3671259
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00584
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RNASET2(Ribonuclease T2) is also named as RNASE6PL(Ribonuclease 6) and belongs to the RNase T2 family. It is a unique member of the growing family of tumor-antagonizing genes and behaves as a class II tumor suppressor and abolish the tumorigenic potential of an ovarian cancer-derived cell line. This protein has 2 isoforms produced by alternative splicing. Both mildly glycosylated (ranging from38 to 45 kDa) and highly glycosylated forms (ranging from 50 to 80 kDa) of human tumor suppressor protein RNASET2 can be detected in immunoblotting in P. Pastoris(PMID: 21446958).

Loading...
||
New chat

Able

正在加载,请稍候...