RNASET2 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of BxPC-3 using 83650-3-RR (same clone as 83650-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed BxPC-3 cells using RNASET2 antibody (83650-3-RR, Clone: 240581H5 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83650-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83650-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83650-3-RR against Human RNASET2 were performed. The affinity constant is below 1 pM.

RNASET2 Uni-rAb^® Recombinant Antibody for IF/ICC, ELISA

Cat No. 83650-3-PBS

Clone No.240581H5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, ELISA

Synonyms

RNase T2, Ribonuclease T2, Ribonuclease 6, EC:4.6.1.19, bA514O12.3

---

Product Information

83650-3-PBS targets RNASET2 in IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28353

  Product name: Recombinant human RNASET2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 25-256 aa of BC039713

  Sequence: DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH

• Full Name: ribonuclease T2
• Calculated Molecular Weight: 256 aa, 29 kDa
• GenBank Accession Number: BC039713
• Gene Symbol: RNase T2
• Gene ID (NCBI): 8635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O00584
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.