RND1 Polyclonal antibody

• 

RND1 Polyclonal Antibody for IHC, ELISA

Cat No. 13786-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

ARHS, Rho family GTPase 1, RHO6, RHOS, RND1

---

Product Information

13786-1-AP targets RND1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4801

  Product name: Recombinant human RND1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-232 aa of BC026356

  Sequence: MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM

• Full Name: Rho family GTPase 1
• Calculated Molecular Weight: 232 aa, 26 kDa
• GenBank Accession Number: BC026356
• Gene Symbol: RND1
• Gene ID (NCBI): 27289
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92730
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.