RNF112 Polyclonal antibody

• 

  WB analysis of mouse kidney using 25165-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 25165-1-AP (RNF112 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 25165-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25165-1-AP (RNF112 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

RNF112 Polyclonal Antibody for WB, ELISA

Cat No. 25165-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF, IHC, ELISA

Synonyms

BFP, ring finger protein 112, RNF112, ZNF179

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

25165-1-AP targets RNF112 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18306

  Product name: Recombinant human RNF112 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 287-631 aa of BC053989

  Sequence: DLDYLEMFVHVAEVMGKHYGMVPIQHLDLLVRDSSHPNKAGQGHVGNIFQRLSGRYPKVQELLQGKRARCCLLPAPGRRRMNQGHASPGDTDDDFRHLLGAYVSDVLSAAPQHAKSRCQGYWNEGRAVARGDRRLLTGQQLAQEIKNLSGWMGRTGPGFTSPDEMAAQLHDLRKVEAAKREFEEYVRQQDVATKRIFSALRVLPDTMRNLLSTQKDAILARHGVALLCKGRDQTLEALEAELQATAKAFMDSYTMRFCGHLAAVGGAVGAGLMGLAGGVVGAGMAAAALAAEAGMVAAGAAVGATGAAVVGGGVGAGLAATVGCMEKEEDERLLEGDREPLLQEE

• Full Name: ring finger protein 112
• Calculated Molecular Weight: 631 aa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC053989
• Gene Symbol: RNF112
• Gene ID (NCBI): 7732
• RRID: AB_2879935
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULX5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC,IF	JCI Insight; RNF112-mediated FOXM1 ubiquitination suppresses the proliferation and invasion of gastric cancer; Authors - Shengwei Zhang