RNF123 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RNF123 Polyclonal antibody, PBS Only (25260-1-PBS)

• 

  WB analysis using 25260-1-AP (same clone as 25260-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25260-1-AP (RNF123 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25260-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 25260-1-AP (same clone as 25260-1-PBS)

  IP result of anti-RNF123 (IP:25260-1-AP, 4ug; Detection:25260-1-AP 1:600) with HeLa cells lysate 1200 ug. This data was developed using the same antibody clone with 25260-1-PBS in a different storage buffer formulation.

RNF123 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 25260-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

25260-1-PBS targets RNF123 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19653

  Product name: Recombinant human RNF123 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 12-358 aa of BC130632

  Sequence: RKSYRLTSDAEKSRVTGIVQEKLLNDYLNRIFSSSEHAPPAATSRKPLNFQNLPEHLDQLLQVDNEEEESQGQVEGRLGPSTVVLDHTGGFEGLLLVDDDLLGVIGHSNFGTIRSTTCVYKGKWLYEVLISSQGLMQIGWCTISCRFNQEEGVGDTHNSYAYDGNRVRKWNVTTTNYGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAFENLSRGLGMAYFPAISLSFKESVAFNFGSRPLRYPVAGYRPLQDPPSADLVRAQRLLGCFRAVLSVELDPVEGRLLDKESSKWRLRGQPTVLLTLAHIFHHFAPLLRKVYLVEAVLMSFLLGIVEKGTPTQAQSVV

• Full Name: ring finger protein 123
• Calculated Molecular Weight: 1314 aa, 149 kDa
• Observed Molecular Weight: 149 kDa
• GenBank Accession Number: BC130632
• Gene Symbol: RNF123
• Gene ID (NCBI): 63891
• RRID: AB_3669467
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5XPI4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RING finger protein 123 (RNF123), also known as KPC1, is an E3 ubiquitin ligase that belongs to the RING-finger family of ligases that contain a 40-60-amino acid long RING domain which is essential for causing substrate ubiquitination (PMID: 29676528). RNF123 promoted TLR3/IRF7-induced type I IFN signaling and inhibited viral replication by degrading SOCS1 (PMID: 37014223).