RNF128 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RNF128 Polyclonal antibody (26015-1-AP)

• Featured Product
• KD/KO Validated

RNF128 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26015-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

E3 ubiquitin-protein ligase RNF128, EC:2.3.2.27, GRAIL, RING finger protein 128, RING-type E3 ubiquitin transferase RNF128

• 

  WB analysis using 26015-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26015-1-AP (RNF128 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 26015-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26015-1-AP (RNF128 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 26015-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26015-1-AP (RNF128 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RNF128 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, rat kidney tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26015-1-AP targets RNF128 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22834

  Product name: Recombinant human RNF128 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 333-428 aa of BC063404

  Sequence: DGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETAVREIKS

• Full Name: ring finger protein 128
• Calculated Molecular Weight: 428 aa, 47 kDa
• Observed Molecular Weight: 40-47 kDa, 66-70 kDa
• GenBank Accession Number: BC063404
• Gene Symbol: RNF128
• Gene ID (NCBI): 79589
• RRID: AB_2880336
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TEB7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RNF128 Polyclonal antibody (Cat# 26015-1-AP) has 1 total citation. It appears in Stem Cell Research & Therapy (IF 7.8), published in January 2021. The cited study investigated the role of splicing factor hnRNP A2B1 in melanoma stem cell tumorigenesis, using this antibody for Western blot validation in human samples. The research field encompasses melanoma biology, cancer stem cells, and RNA splicing regulation.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Stem Cell Res Ther; Requirement of splicing factor hnRNP A2B1 for tumorigenesis of melanoma stem cells.; Authors - Mengqi Chu ; KD Validated