RNF135 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of PC-12 using 84984-1-RR (same clone as 84984-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-12 cells using RNF135 antibody (84984-1-RR, Clone: 241606D8 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84984-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84984-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84984-1-RR against Human RNF135 were performed. The affinity constant is 49.1 nM.

RNF135 Uni-rAb^® Recombinant Antibody for IF/ICC, Indirect ELISA

Cat No. 84984-1-PBS

Clone No.241606D8

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IF/ICC, Indirect ELISA

Synonyms

RIG I E3 ubiquitin ligase, REUL, L13, EC:2.3.2.27, E3 ubiquitin-protein ligase RNF135

---

Product Information

84984-1-PBS targets RNF135 in IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18821

  Product name: Recombinant human RNF135 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-210 aa of BC005084

  Sequence: MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKENSWKPRLPPHAHCLTRATLHSGELLGLLSGPSIQPLT

• Full Name: ring finger protein 135
• Calculated Molecular Weight: 432 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC005084
• Gene Symbol: RNF135
• Gene ID (NCBI): 84282
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8IUD6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ring finger protein 135 (RNF135), located on chromosome 17q11.2, is a RING finger domain-containing E3 ubiquitin ligase that was identified as a bio-marker and therapy target of glioblastoma (PMID: 26856755). RNF135 facilitates RIG-I C-terminal ubiquitination to up-regulate RIG-I-mediated IFN signaling and suppress viral replication.