Tested Applications
| Positive WB detected in | HeLa cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human kidney tissue, mouse kidney tissue, rat adrenal gland tissue, mouse adrenal gland tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26306-1-AP targets RNF144B/IBRDC2 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23679 Product name: Recombinant human RNF144B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 123-187 aa of BC063311 Sequence: VADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAE Predict reactive species |
| Full Name | ring finger protein 144B |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC063311 |
| Gene Symbol | RNF144B |
| Gene ID (NCBI) | 255488 |
| RRID | AB_2880473 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z419 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RNF144B/IBRDC2 antibody 26306-1-AP | Download protocol |
| IP protocol for RNF144B/IBRDC2 antibody 26306-1-AP | Download protocol |
| WB protocol for RNF144B/IBRDC2 antibody 26306-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RNF144B/IBRDC2 Polyclonal antibody (Cat# 26306-1-AP) has 1 total citation. The cited publication appeared in EMBO Reports (2024), investigating how RNF144B negatively regulates antiviral immunity by targeting MDA5 for autophagic degradation. The research field encompasses antiviral immunity and protein degradation pathways.
| Species | Application | Title |
|---|---|---|
EMBO Rep RNF144B negatively regulates antiviral immunity by targeting MDA5 for autophagic degradation |















