RNF145 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RNF145 Polyclonal antibody (24524-1-AP)

• Featured Product
• KD/KO Validated

RNF145 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24524-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

EC:2.3.2.27, RING finger protein 145

• 

  WB analysis using 24524-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24524-1-AP (RNF145 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 24524-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24524-1-AP (RNF145 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 24524-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24524-1-AP (RNF145 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 24524-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24524-1-AP (RNF145 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RNF145 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse kidney tissue, HepG2 cells, rat kidney tissue
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24524-1-AP targets RNF145 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21463

  Product name: Recombinant human RNF145 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 492-663 aa of BC042684

  Sequence: IHSYYNVWLRAQLGWKSFLLRRDAVNKIKSLPIATKEQLEKHNDICAICYQDMKSAVITPCSHFFHAGCLKKWLYVQETCPLCHCHLKNSSQLPGLGTEPVLQPHAGAEQNVMFQEGTEPPGQEHTPGTRIQEGSRDNNEYIARRPDNQEGAFDPKEYPHSAKDEVHPVESA

• Full Name: ring finger protein 145
• Calculated Molecular Weight: 663 aa, 76 kDa
• Observed Molecular Weight: 76-79 kDa
• GenBank Accession Number: BC042684
• Gene Symbol: RNF145
• Gene ID (NCBI): 153830
• RRID: AB_2879589
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MT1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RNF145 Polyclonal antibody (Cat# 24524-1-AP) has 5 total citations. These appear in EMBO Journal, Journal of Agricultural and Food Chemistry, Oncology Research, World Journal of Surgical Oncology, and eLife. Research fields span lipid metabolism and membrane fluidity regulation, mTOR signaling and milk synthesis in mammary epithelial cells, hepatocellular carcinoma metastasis and prognosis, and sterol-responsive ubiquitin-mediated degradation of HMG-CoA reductase. Applications include Western blotting and immunoprecipitation, primarily in human and mouse samples.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	EMBO J; Regulation of membrane fluidity by RNF145-triggered degradation of the lipid hydrolase ADIPOR2; Authors - Norbert Volkmar ; KO Validated
mouse	WB	J Agric Food Chem; Methionine and Leucine Promote mTOR Gene Transcription and Milk Synthesis in Mammary Epithelial Cells through the eEF1Bα-UBR5-ARID1A Signaling; Authors - Hao Qi
human	WB	Oncol Res; RNF145 Promotes Hepatocellular Carcinoma Metastasis through Ubiquitination and Degradation of PCDH9.; Authors - Huan Zhang ; KD Validated
human	WB	World J Surg Oncol; Hypoxia-based classification and prognostic signature for clinical management of hepatocellular carcinoma; Authors - Ke Li
human	WB,IP	Elife; The sterol-responsive RNF145 E3 ubiquitin ligase mediates the degradation of HMG-CoA reductase together with gp78 and Hrd1.; Authors - Sam A Menzies