RNF150 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RNF150 Polyclonal antibody (21438-1-AP)

• KD/KO Validated

RNF150 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21438-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, CoIP, ELISA

Synonyms

KIAA1214, ring finger protein 150, RNF150

• 

  WB analysis of mouse lung using 21438-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21438-1-AP (RNF150 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse eye using 21438-1-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 21438-1-AP (RNF150 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 21438-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 21438-1-AP (RNF150 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 21438-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21438-1-AP (RNF150 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 21438-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 21438-1-AP (RNF150 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 21438-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 21438-1-AP (RNF150 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 21438-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 21438-1-AP (RNF150 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RNF150 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse lung tissue, human heart tissue, mouse brain tissue, mouse eye tissue, Y79 cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21438-1-AP targets RNF150 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16064

  Product name: Recombinant human RNF150 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 92-211 aa of BC101992

  Sequence: LERNITVTMYITIGTRNLQKYVSRTSVVFVSISFIVLMIISLAWLVFYYIQRFRYANARDRNQRRLGDAAKKAISKLQIRTIKKGDKETESDFDNCAVCIEGYKPNDVVRILPCRHLFHK

• Full Name: ring finger protein 150
• Calculated Molecular Weight: 438 aa, 48 kDa
• Observed Molecular Weight: 43-44 kDa
• GenBank Accession Number: BC101992
• Gene Symbol: RNF150
• Gene ID (NCBI): 57484
• RRID: AB_10733469
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULK6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The RING finger (RNF) family, containing the N-terminal RING domain, is the largest E3 ubiquitin ligase family with 340 validated human members (PMID: 25609945). RNF150 proteins belong to the Goliath family and are involved in apoptosis and embryonic development (PMID: 19690564). RNF150 might be involved in the progression of GC partly via heparin binding which correlates well with angiogenesis and hematogenous metastasis (PMID: 37528105). There are four isoforms of RNF150, 48kDa, 44kDa, 43kDa, 32 kDa respectively.

Publications

What published studies show

The RNF150 Polyclonal antibody (Cat# 21438-1-AP) has a total of 1 citation. It appears in Cell Biology International (2023), in a study investigating RNF150's role in suppressing papillary thyroid carcinoma through ASK1 ubiquitination and inactivation of the p38 signaling axis. The associated research fields include cancer biology, ubiquitination, and intracellular signaling pathways.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	Cell Biol Int; RNF150 suppresses papillary thyroid carcinoma with ASK1 ubiquitination presenting a direct target via inactivating p38 signaling axis; Authors - Wei Deng