RNF150 Polyclonal antibody

• 

  WB analysis of mouse lung using 21438-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21438-1-AP (RNF150 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse eye using 21438-1-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 21438-1-AP (RNF150 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Y79 using 21438-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 21438-1-AP (RNF150 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 21438-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21438-1-AP (RNF150 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 21438-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 21438-1-AP (RNF150 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 21438-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 21438-1-AP (RNF150 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 21438-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 21438-1-AP (RNF150 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RNF150 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21438-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, CoIP, ELISA

Synonyms

KIAA1214, ring finger protein 150, RNF150

---

Tested Applications

• Positive WB detected in: mouse lung tissue, human heart tissue, mouse brain tissue, mouse eye tissue, Y79 cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• CoIP: See 1 publications below

Product Information

21438-1-AP targets RNF150 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16064

  Product name: Recombinant human RNF150 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 92-211 aa of BC101992

  Sequence: LERNITVTMYITIGTRNLQKYVSRTSVVFVSISFIVLMIISLAWLVFYYIQRFRYANARDRNQRRLGDAAKKAISKLQIRTIKKGDKETESDFDNCAVCIEGYKPNDVVRILPCRHLFHK

• Full Name: ring finger protein 150
• Calculated Molecular Weight: 438 aa, 48 kDa
• Observed Molecular Weight: 43-44 kDa
• GenBank Accession Number: BC101992
• Gene Symbol: RNF150
• Gene ID (NCBI): 57484
• RRID: AB_10733469
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULK6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The RING finger (RNF) family, containing the N-terminal RING domain, is the largest E3 ubiquitin ligase family with 340 validated human members (PMID: 25609945). RNF150 proteins belong to the Goliath family and are involved in apoptosis and embryonic development (PMID: 19690564). RNF150 might be involved in the progression of GC partly via heparin binding which correlates well with angiogenesis and hematogenous metastasis (PMID: 37528105). There are four isoforms of RNF150, 48kDa, 44kDa, 43kDa, 32 kDa respectively.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	Cell Biol Int; RNF150 suppresses papillary thyroid carcinoma with ASK1 ubiquitination presenting a direct target via inactivating p38 signaling axis; Authors - Wei Deng