RNF181 Recombinant monoclonal antibody, PBS Only (Capture)

RNF181 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 85735-2-PBS
Clone No.243121B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

E3 ubiquitin-protein ligase RNF181, EC:2.3.2.27, HSPC238, RING finger protein 181, RN181

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85735-2-PBS targets RNF181 as part of a matched antibody pair:

MP02066-1: 85735-2-PBS capture and 85735-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14233

Product name: Recombinant human RNF181 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-153 aa of BC002803

Sequence: MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT

Predict reactive species
Full Name ring finger protein 181
Calculated Molecular Weight 153 aa, 18 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC002803
Gene Symbol RNF181
Gene ID (NCBI) 51255
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9P0P0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RNF181, also named as HSPC238, is a 153 amino acid protein, which belongs to the RNF181 family. RNF181 is widely expressed, with highest levels in liver and heart and lowest levels in brain and skeletal muscle. RNF181 as a E3 ubiquitin-protein ligase, accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Loading...
||
New chat Able
正在加载,请稍候...