RNF185 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RNF185 Polyclonal antibody, PBS Only (32956-1-PBS)

• 

  WB analysis using 32956-1-AP (same clone as 32956-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32956-1-AP (RNF185 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32956-1-PBS in a different storage buffer formulation.

RNF185 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32956-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

E3 ubiquitin-protein ligase RNF185, EC:2.3.2.27, RING finger protein 185

---

Product Information

32956-1-PBS targets RNF185 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38937

  Product name: Recombinant human RNF185 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-130 aa of NM_152267.3

  Sequence: MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGD

• Full Name: ring finger protein 185
• Calculated Molecular Weight: 20kDa，192aa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: NM_152267.3
• Gene Symbol: RNF185
• Gene ID (NCBI): 91445
• RRID: AB_3742804
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96GF1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RNF185 is a RING finger domain-containing ubiquitin ligase implicated in ER-associated degradation. It is the MOM E3 ligase responsible for regulation of mitochondrial autophagy (PMID: 21931693).