RNF187 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RNF187 Polyclonal antibody (32939-1-AP)

• 

  IP experiment of Ramos using 32939-1-AP

  IP result of anti-RNF187 (IP:32939-1-AP, 4ug; Detection:32939-1-AP 1:1000) with Ramos cells lysate 1000 ug.

• 

  IF Staining of U2OS using 32939-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using RNF187 antibody (32939-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

RNF187 Polyclonal Antibody for IF/ICC, IP, ELISA

Cat No. 32939-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, IP, ELISA

Synonyms

E3 ubiquitin-protein ligase RNF187, EC:2.3.2.27, HA2K, RACO-1, RING domain AP1 coactivator 1

---

Tested Applications

• Positive IP detected in: Ramos cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32939-1-AP targets RNF187 in IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36665

  Product name: Recombinant human RNF187 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 120-235 aa of BC012758

  Sequence: EPRWRKALRGKENKGSVEIMRKDLNDARDLHGQAESAAAVWKGHVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDELADPTERFRSLLQAVSELEKKHRNLGLSMLLQ

• Full Name: ring finger protein 187
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC012758
• Gene Symbol: RNF187
• Gene ID (NCBI): 149603
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5TA31
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RNF187 (Ring Finger Protein 187) is an E3 ubiquitin ligase with a molecular weight of approximately 28 kDa. It belongs to the RING finger protein family and participates in protein degradation and signal transduction regulation by catalyzing the ubiquitination of substrate proteins. In cancer research, RNF187 is upregulated in various malignant tumors, including melanoma and breast cancer, where it promotes tumor proliferation and invasion through ubiquitin-mediated degradation of tumor suppressors or regulation of cyclins. Additionally, RNF187 is involved in oxidative stress responses and DNA damage repair, playing a role in cell survival and maintenance of genomic stability. In research settings, anti-RNF187 antibodies are widely used for studying ubiquitination mechanisms, analyzing tumor signaling pathways, and exploring skin disease models.