• Featured Product
  • KD/KO Validated

RNF2 Recombinant monoclonal antibody, PBS Only

RNF2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 84793-5-PBS
Clone No.242181G7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

242181G7, BAP 1, BAP1, DING, E3 ubiquitin-protein ligase RING2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84793-5-PBS targets RNF2 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8900

Product name: Recombinant human RNF2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-336 aa of BC012583

Sequence: MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK

Predict reactive species
Full Name ring finger protein 2
Calculated Molecular Weight 336 aa, 38 kDa
Observed Molecular Weight38 kDa
GenBank Accession NumberBC012583
Gene Symbol RNF2
Gene ID (NCBI) 6045
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ99496
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RNF2 (also known as ding, Ring1B or Ring2) is a member of the Ring finger protein family, which functions as E3 ubiquitin ligase for monoubiquitination of histone H2A at lysine 119 (H2AK119ub). Many studies have demonstrated that overexpressed RNF2 was involved in the pathological progression of multiple cancers and has an impact on their clinical features. For instance, the upregulated expression level of RNF2 is positively correlated with the occurrence and progression of hepatocellular carcinoma, melanoma, prostate cancer, breast cancer, pancreatic cancer, gastric cancer, and bladder urothelial carcinoma, as well as with the radioresistance of lung cancer and chemoresistance of ovarian cancer (PMID: 33400276). The molecular weight of RNF2 is 38 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...