RNF32 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RNF32 Polyclonal antibody, PBS Only (17471-1-PBS)

• 

  WB analysis using 17471-1-AP (same clone as 17471-1-PBS)

  Mouse testis tissue were subjected to SDS PAGE followed by western blot with 17471-1-AP (RNF32 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17471-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 17471-1-AP (same clone as 17471-1-PBS)

  Rat testis tissue were subjected to SDS PAGE followed by western blot with 17471-1-AP (RNF32 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17471-1-PBS in a different storage buffer formulation.

RNF32 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17471-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

FKSG33, HSD15

---

Product Information

17471-1-PBS targets RNF32 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11428

  Product name: Recombinant human RNF32 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4-221 aa of BC028120

  Sequence: NKGHSSKKDNLAVNAVALQDHILHDLQLRNLSVADHSKTQVQKKENKSLKRDTKAIIDTGLKKTTQCPKLEDSEKEYVLDPKPPPLTLAQKLGLIGPPPPPLSSDEWEKVKQRSLLQGDSVQPCPICKEEFELRPQVLLSCSHVFHKACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGCVVRKWYRNLRKTVPPTDAKLR

• Full Name: ring finger protein 32
• Calculated Molecular Weight: 362 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC028120
• Gene Symbol: RNF32
• Gene ID (NCBI): 140545
• RRID: AB_3741919
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H0A6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ring Finger Protein 32 (RNF32) is a member of the RING finger protein family, characterized by a RING domain that functions as an E3 ubiquitin ligase. RNF32 is specifically expressed in testis and ovary. Studies indicate that RNF32 is expressed during spermatogenesis, most likely in spermatocytes and/or in spermatids, suggesting a possible role in sperm formation (PMID: 11890671, PMID: 41167191).