RNF34 Polyclonal antibody

• 

  IHC staining of human breast cancer using 10629-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10629-1-AP (RNF34 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 10629-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10629-1-AP (RNF34 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

RNF34 Polyclonal Antibody for IHC, ELISA

Cat No. 10629-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

CARP 1, CARP-1, Caspase regulator CARP1, Caspases-8 and -10-associated RING finger protein 1, E3 ubiquitin-protein ligase RNF34

---

Tested Applications

• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IF: See 1 publications below

Product Information

10629-1-AP targets RNF34 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0982

  Product name: Recombinant human RNF34 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 72-372 aa of BC007826

  Sequence: FRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPAQVQSEITSANTEDDDDDDDEDDDDEEENAEDRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRLYKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPICRQYVVRAVHVFKS

• Full Name: ring finger protein 34
• Calculated Molecular Weight: 42 kDa
• GenBank Accession Number: BC007826
• Gene Symbol: RNF34
• Gene ID (NCBI): 80196
• RRID: AB_2301135
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q969K3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RNF34 is an E3 ubiquitin ligase that regulates protein substrates by post-translational modification. It is associated with regulating postsynaptic γ2-GABAAR clustering and GABAergic synaptic innervation in hippocampal neurons, indicating the importance of RNF34 in regulating neurological function.It is preferentially expressed in esophageal, gastric, and colorectal cancers, suggesting a possible association between RNF34 and the development of digestive tract cancers. Immunoblots showed a single 42-kDa protein band corresponding to the molecular weight of RNF34.(PMID: 31704983, PMID: 25193658)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IF	Nat Commun; A ZFYVE21-Rubicon-RNF34 signaling complex promotes endosome-associated inflammasome activity in endothelial cells; Authors - Xue Li ; KD Validated