RNF8 Monoclonal antibody

RNF8 Monoclonal Antibody for WB, ELISA
Cat No. 68521-1-Ig
Clone No.3G3H5

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, rabbit, pig

Applications

WB, ELISA

FLJ12013, KIAA0646, ring finger protein 8, RNF8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, K-562 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68521-1-Ig targets RNF8 in WB, ELISA applications and shows reactivity with Human, mouse, rat, rabbit, pig samples.

Tested Reactivity Human, mouse, rat, rabbit, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5292

Product name: Recombinant human RNF8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 130-485 aa of BC007517

Sequence: ETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF

Predict reactive species
Full Name ring finger protein 8
Calculated Molecular Weight 485 aa, 56 kDa
Observed Molecular Weight65-70 kDa
GenBank Accession NumberBC007517
Gene Symbol RNF8
Gene ID (NCBI) 9025
RRIDAB_3085230
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO76064
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RNF8, also named as KIAA0646 or E3 ubiquitin-protein ligase RNF8, is a 485 amino acid protein, which contains one RING-type zinc finger and one FHA domain. RNF8 localizes in the nucleus and belongs to the RNF8 family. E2-E3 ubiquitin ligase complex is composed of the RNF8 homodimer and a E2 heterodimer of UBE2N and UBE2V2. E3 ubiquitin-protein ligase that plays a key role in DNA damage signaling via 2 distinct roles: by mediating the 'Lys-63'-linked ubiquitination of histones H2A and H2AX and promoting the recruitment of DNA repair proteins at double-strand breaks (DSBs) sites, and by catalyzing 'Lys-48'-linked ubiquitination to remove target proteins from DNA damage sites.

Protocols

Product Specific Protocols
WB protocol for RNF8 antibody 68521-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...