RNGTT Polyclonal antibody

• 

  WB analysis of human kidney using 12430-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12430-1-AP (RNGTT antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse kidney using 12430-1-AP

  IP result of anti-RNGTT (IP:12430-1-AP, 4ug; Detection:12430-1-AP 1:500) with mouse kidney tissue lysate 4000ug.

RNGTT Polyclonal Antibody for WB, IP, ELISA

Cat No. 12430-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

CAP1A, GTase, GTP  RNA guanylyltransferase, GTP--RNA guanylyltransferase, hCAP

---

Tested Applications

• Positive WB detected in: human kidney tissue
• Positive IP detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

12430-1-AP targets RNGTT in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3105

  Product name: Recombinant human RNGTT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 242-598 aa of BC019954

  Sequence: TQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFIDRCTAASQGQKRKHHLDPDTELMPPPPPKRPHPLT

• Full Name: RNA guanylyltransferase and 5'-phosphatase
• Calculated Molecular Weight: 597 aa, 69 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC019954
• Gene Symbol: RNGTT
• Gene ID (NCBI): 8732
• RRID: AB_2181385
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60942
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RNGTT(mRNA-capping enzyme) is also named as HCAP1, HCE, CAP1A. In the N-terminal section it belongs to the non-receptor class of the protein-tyrosine phosphatase family and in the C-terminal section it belongs to the eukaryotic GTase family. It is a bifunctional 597-amino acid protein with RNA triphosphatase and RNA guanylyltransferase activities(PMID:9545288). It has 4 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Redundant pathways for removal of defective RNA polymerase II complexes at a promoter-proximal pause checkpoint; Authors - Daniel Blears