RNGTT Recombinant monoclonal antibody, PBS Only (Capture)

RNGTT Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83974-2-PBS
Clone No.240927A10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

240927A10, CAP1A, GTase, GTP  RNA guanylyltransferase, GTP--RNA guanylyltransferase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83974-2-PBS targets RNGTT as part of a matched antibody pair:

MP00899-2: 83974-2-PBS capture and 83974-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3105

Product name: Recombinant human RNGTT protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 242-598 aa of BC019954

Sequence: TQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFIDRCTAASQGQKRKHHLDPDTELMPPPPPKRPHPLT

Predict reactive species
Full Name RNA guanylyltransferase and 5'-phosphatase
Calculated Molecular Weight 597 aa, 69 kDa
Observed Molecular Weight62-68 kDa
GenBank Accession NumberBC019954
Gene Symbol RNGTT
Gene ID (NCBI) 8732
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO60942
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RNGTT(mRNA-capping enzyme) is also named as HCAP1, HCE, CAP1A. In the N-terminal section it belongs to the non-receptor class of the protein-tyrosine phosphatase family and in the C-terminal section it belongs to the eukaryotic GTase family. It is a bifunctional 597-amino acid protein with RNA triphosphatase and RNA guanylyltransferase activities(PMID:9545288). It has 4 isoforms produced by alternative splicing.

Loading...
||
New chat

Able

正在加载,请稍候...