ROBO2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ROBO2 Polyclonal antibody (21635-1-AP)

ROBO2 Polyclonal Antibody for WB, ELISA

Cat No. 21635-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

KIAA1568, ROBO2, Roundabout homolog 2, SAX3

• 

  WB analysis using 21635-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21635-1-AP (ROBO2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ROBO2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21635-1-AP targets ROBO2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16261

  Product name: Recombinant human ROBO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1156-1378 aa of BC146772

  Sequence: SPREEMQPMLQAHLDELTRAYQFDIAKQTWHIQSNNQPPQPPVPPLGYVSGALISDLETDVADDDADDEEEALEIPRPLRALDQTPGSSMDNLDSSVTGKAFTSSQRPRPTSPFSTDSNTSAALSQSQRPRPTKKHKGGRMDQQPALPHRREGMTDEEALVPYSKPSFPSPGGHSSSGTASSKGSTGPRKTEVLRAGHQRNASDLLDIGYMGSNSQGQFTGEL

• Full Name: roundabout, axon guidance receptor, homolog 2 (Drosophila)
• Calculated Molecular Weight: 1378 aa, 151 kDa
• Observed Molecular Weight: 180 kDa
• GenBank Accession Number: BC146772
• Gene Symbol: ROBO2
• Gene ID (NCBI): 6092
• RRID: AB_2878893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCK4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ROBO2 Polyclonal antibody (Cat# 21635-1-AP) has 3 total citations. These appear in Materials Today Bio, Communications Biology, and Annals of Anatomy. The associated research fields include osteoarthritis therapy via exosome-based miRNA delivery, Zika virus effects on neural lineage differentiation, and osteoblast differentiation and mineralization regulated by autophagy and parathyroid hormone signaling. All cited studies used mouse samples with WB and/or IHC applications.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IHC	Mater Today Bio; A microsphere loaded with chondrocyte-targeting exosomes continuously deliver miR-148a for osteoarthritis therapy.; Authors - Tao Yang
mouse	WB	Commun Biol; ZIKV envelope protein is a strong blocker of early directional differentiation in the neural lineage.; Authors - Zi-Hui Ma
mouse	WB	Ann Anat; Robo2 promotes osteoblast differentiation and mineralization through autophagy and is activated by parathyroid hormone induction; Authors - Ning Yuan ; KD Validated