ROBO2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ROBO2 Polyclonal antibody (21635-1-AP)

• 

  WB analysis using 21635-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21635-1-AP (ROBO2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

ROBO2 Polyclonal Antibody for WB, ELISA

Cat No. 21635-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

KIAA1568, ROBO2, Roundabout homolog 2, SAX3

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 1 publications below

Product Information

21635-1-AP targets ROBO2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16261

  Product name: Recombinant human ROBO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1156-1378 aa of BC146772

  Sequence: SPREEMQPMLQAHLDELTRAYQFDIAKQTWHIQSNNQPPQPPVPPLGYVSGALISDLETDVADDDADDEEEALEIPRPLRALDQTPGSSMDNLDSSVTGKAFTSSQRPRPTSPFSTDSNTSAALSQSQRPRPTKKHKGGRMDQQPALPHRREGMTDEEALVPYSKPSFPSPGGHSSSGTASSKGSTGPRKTEVLRAGHQRNASDLLDIGYMGSNSQGQFTGEL

• Full Name: roundabout, axon guidance receptor, homolog 2 (Drosophila)
• Calculated Molecular Weight: 1378 aa, 151 kDa
• Observed Molecular Weight: 180 kDa
• GenBank Accession Number: BC146772
• Gene Symbol: ROBO2
• Gene ID (NCBI): 6092
• RRID: AB_2878893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCK4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IHC	Mater Today Bio; A microsphere loaded with chondrocyte-targeting exosomes continuously deliver miR-148a for osteoarthritis therapy.; Authors - Tao Yang
mouse	WB	Commun Biol; ZIKV envelope protein is a strong blocker of early directional differentiation in the neural lineage.; Authors - Zi-Hui Ma
mouse	WB	Ann Anat; Robo2 promotes osteoblast differentiation and mineralization through autophagy and is activated by parathyroid hormone induction; Authors - Ning Yuan ; KD Validated