ROCK2(middle) Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ROCK2(middle) Recombinant monoclonal antibody (86649-4-RR)

ROCK2(middle) Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86649-4-RR

Clone No.251651F9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ROCK2, EC:2.7.11.1, KIAA0619, p164 ROCK-2, Rho kinase 2

• 

  WB analysis using 86649-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86649-4-RR (ROCK2(middle) antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: MCF-7 cells, L02 cells, HT-1080 cells, mouse brain tissue, rat brain tissue, mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86649-4-RR targets ROCK2(middle) in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16330

  Product name: Recombinant human ROCK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-180 aa of BC111801

  Sequence: MEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQ

• Full Name: Rho-associated, coiled-coil containing protein kinase 2
• Calculated Molecular Weight: 77 kDa, 161 kDa
• Observed Molecular Weight: 161 kDa
• GenBank Accession Number: BC111801
• Gene Symbol: ROCK2
• Gene ID (NCBI): 9475
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75116
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ROCK2 is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. It is an isozyme of ROCK1, is a target for the small GTPase Rho. ROCK2 is localized in both cytoplasm and nucleus, and the nucleus-localized ROCK2 can target p300 for phosphorylation to regulate its acetyltransferase activity (PMID:16574662).This antibody is specific to ROCK2.