ROMO1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ROMO1 Polyclonal antibody (24200-1-AP)

• Featured Product
• KD/KO Validated

ROMO1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24200-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

C20orf52, Epididymis tissue protein Li 175, Glyrichin, Mitochondrial targeting GxxxG motif protein, MTGM

• 

  WB analysis of HEK-293 using 24200-1-AP

  WB result of ROMO1 antibody (24200-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-ROMO1 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 24200-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 24200-1-AP (ROMO1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 24200-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 24200-1-AP (ROMO1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 24200-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 24200-1-AP (ROMO1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 24200-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 24200-1-AP (ROMO1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ROMO1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IHC detected in: human lung cancer tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24200-1-AP targets ROMO1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20368

  Product name: Recombinant human ROMO1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-79 aa of BC008488

  Sequence: MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC

• Full Name: reactive oxygen species modulator 1
• Calculated Molecular Weight: 79 aa, 8 kDa
• Observed Molecular Weight: 6-10 kDa
• GenBank Accession Number: BC008488
• Gene Symbol: ROMO1
• Gene ID (NCBI): 140823
• RRID: AB_2879453
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P60602
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-ROMO1 antibody (Cat# 24200-1-AP) has 8 total citations across journals including EMBO Journal, Journal of Cell Biology, Free Radical Biology and Medicine, Journal of Nanobiotechnology, Fluids & Barriers of the CNS, Cell Division, Neurochemical Research, and Journal of Molecular Neuroscience. Research fields span mitochondrial biology, oxidative stress, apoptosis, cancer (ovarian, hepatocellular), neuroprotection, mitophagy, and preimplantation embryo development.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Nanobiotechnology; Metal-organic framework-encapsulated dihydroartemisinin nanoparticles induces apoptotic cell death in ovarian cancer by blocking ROMO1-mediated ROS production; Authors - Yuanliang Yan
human	WB	EMBO J; Stress-induced OMA1-mediated cleavage of AIFM1 suppresses cell growth by controlling mitochondrial OXPHOS activity.; Authors - Mitsuhiro Nishigori
human	WB	Free Radic Biol Med; TRAF2 inhibits senescence in hepatocellular carcinoma cells via regulating the ROMO1/ NAD+/SIRT3/SOD2 axis; Authors - Jiping Yao ; KD Validated
rat	WB	Fluids Barriers CNS; Rh-relaxin-2 attenuates oxidative stress and neuronal apoptosis via ERK-nNOS-NO pathway after germinal matrix hemorrhage in rats; Authors - Jun Liu
human	WB	J Cell Biol; ROMO1 is a constituent of the human presequence translocase required for YME1L protease import.; Authors - Frank Richter ; KD Validated
pig	WB,IF	Cell Div; ROMO1 is required for mitochondrial metabolism during preimplantation embryo development in pigs.; Authors - Dongjie Zhou ; KD Validated