ROPN1B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ROPN1B Polyclonal antibody (33925-1-AP)

• 

  WB analysis using 33925-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33925-1-AP (ROPN1B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

ROPN1B Polyclonal Antibody for WB, ELISA

Cat No. 33925-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Rhophilin-associated protein 1B, Ropporin-1B

---

Tested Applications

• Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33925-1-AP targets ROPN1B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40678

  Product name: Recombinant human ROPN1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-90 aa of BC141849

  Sequence: MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAEEL

• Full Name: ropporin, rhophilin associated protein 1B
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC141849
• Gene Symbol: ROPN1B
• Gene ID (NCBI): 152015
• RRID: AB_3743113
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BZX4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ropporin-1B (ROPN1B), cancer-restricted antigen, is highly expressed and immunogenic, inducing humoral immunity in patients with advanced metastatic melanoma (PMID: 33918976). It is important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, it plays a role in PKA-dependent signaling processes required for spermatozoa capacitation (PMID: 23303679).