Tested Applications
| Positive WB detected in | human testis tissue, mouse testis tissue, rat testis tissue |
| Positive IHC detected in | rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
34136-1-AP targets ROPN1B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10787 Product name: Recombinant human ROPN1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC015413 Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE Predict reactive species |
| Full Name | ropporin, rhophilin associated protein 1B |
| Calculated Molecular Weight | 120 aa, 24 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC015413 |
| Gene Symbol | ROPN1B |
| Gene ID (NCBI) | 152015 |
| RRID | AB_3743160 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9BZX4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ropporin-1B (ROPN1B), cancer-restricted antigen, is highly expressed and immunogenic, inducing humoral immunity in patients with advanced metastatic melanoma (PMID: 33918976). It is important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, it plays a role in PKA-dependent signaling processes required for spermatozoa capacitation (PMID: 23303679).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ROPN1B antibody 34136-1-AP | Download protocol |
| WB protocol for ROPN1B antibody 34136-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



