• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated ROR1 Monoclonal antibody

ROR1 Monoclonal Antibody for
Cat No. CL594-66923
Clone No.1F5D8

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

NTRKR1, Neurotrophic tyrosine kinase, receptor-related 1, Inactive tyrosine-protein kinase transmembrane receptor ROR1, 1F5D8

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL594-66923 targets ROR1 in applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14586

Product name: Recombinant human ROR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 250-364 aa of BC006374

Sequence: DECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRN

Predict reactive species
Full Name receptor tyrosine kinase-like orphan receptor 1
Calculated Molecular Weight 937 aa, 104 kDa
GenBank Accession NumberBC006374
Gene Symbol ROR1
Gene ID (NCBI) 4919
RRIDAB_2920057
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ01973
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ROR1 is a member of the RTK family of orphan receptors related to muscle specific kinase and Trk neurotrophin receptors (PMID: 18546292). ROR1 is primarily expressed by neural crest cells during embryogenesis. High expression of ROR1 is reported in many types of malignancies and is thought to be involved in tumor growth, apoptosis, and epithelial-mesenchymal transition (PMID: 26245996). The human ROR1 gene encodes a 937-amino acid protein with an Ig-like domain, a cysteine-rich domain, a kringle domain, a tyrosine kinase domain and a proline-rich domain. The calculated molecular weight of ROR1 is 104 kDa, but ROR1 has multiple N-glycosylation sites that generate post-translationally modified ROR1 at 130 kDa (PMID: 24752542).

Loading...
||
New chat Able
正在加载,请稍候...