• Featured Product
  • KD/KO Validated

ROR2 Polyclonal antibody

ROR2 Polyclonal Antibody for WB, ELISA
Cat No. 25842-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

BDB, BDB1, EC:2.7.10.1, Neurotrophic tyrosine kinase, receptor-related 2, NTRKR2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HepG2 cells, T-47D cells, K-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25842-1-AP targets ROR2 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22959

Product name: Recombinant human ROR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 781-943 aa of BC130522

Sequence: VSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYIPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNAPEDGAQSTVQEAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA

Predict reactive species
Full Name receptor tyrosine kinase-like orphan receptor 2
Calculated Molecular Weight 943 aa, 105 kDa
Observed Molecular Weight105 kDa
GenBank Accession NumberBC130522
Gene Symbol ROR2
Gene ID (NCBI) 4920
RRIDAB_2918094
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ01974
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tyrosine-protein kinase transmembrane receptor ROR2 belongs to the ROR-family of receptor tyrosine kinases (RTKs) (PMID: 12815588). ROR2 is a developmentally regulated protein that has significant expression and roles in a wide variety of tissues during early embryonic development. It was established that ROR2 plays a key role in skeletal and neural organogenesis, as well as in midgut development in the mouse, but then becomes repressed in adult tissues. It may act as a receptor for wnt ligand WNT5A which may result in the inhibition of WNT3A-mediated signaling (PMID: 25614331). Mutations in ROR2 gene are associated with autosomal recessive Robinow syndrome and autosomal dominant brachydactyly type B (PMID: 12815588).

Protocols

Product Specific Protocols
WB protocol for ROR2 antibody 25842-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Stephen (Verified Customer) (08-02-2022)

IP performed using in HeLa cells in RIPA buffer using 5ug of ror2 antibody per 1ug/ml of protein lysate. pulldown performed using magnetic protein A beads (NEB). western blot probed with another ror2 specific antibody raised in mouse ( MABS1152 )

  • Applications: Immunoprecipitation
  • Primary Antibody Dilution: 5ug of protein used for IP
  • Cell Tissue Type: HeLa
ROR2 Antibody Immunoprecipitation validation (5ug of protein used for IP dilution) in HeLa (Cat no:25842-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...