Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

ROR2 Polyclonal antibody

ROR2 Polyclonal Antibody for WB, ELISA

Cat No. 25842-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

BDB, BDB1, EC:2.7.10.1, Neurotrophic tyrosine kinase, receptor-related 2, NTRKR2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HepG2 cells, T-47D cells, K-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25842-1-AP targets ROR2 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22959

Product name: Recombinant human ROR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 781-943 aa of BC130522

Sequence: VSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYIPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNAPEDGAQSTVQEAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA

Predict reactive species
Full Name receptor tyrosine kinase-like orphan receptor 2
Calculated Molecular Weight 943 aa, 105 kDa
Observed Molecular Weight105 kDa
GenBank Accession NumberBC130522
Gene Symbol ROR2
Gene ID (NCBI) 4920
RRIDAB_2918094
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ01974
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tyrosine-protein kinase transmembrane receptor ROR2 belongs to the ROR-family of receptor tyrosine kinases (RTKs) (PMID: 12815588). ROR2 is a developmentally regulated protein that has significant expression and roles in a wide variety of tissues during early embryonic development. It was established that ROR2 plays a key role in skeletal and neural organogenesis, as well as in midgut development in the mouse, but then becomes repressed in adult tissues. It may act as a receptor for wnt ligand WNT5A which may result in the inhibition of WNT3A-mediated signaling (PMID: 25614331). Mutations in ROR2 gene are associated with autosomal recessive Robinow syndrome and autosomal dominant brachydactyly type B (PMID: 12815588).

Protocols

Product Specific Protocols
WB protocol for ROR2 antibody 25842-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Stephen (Verified Customer) (08-02-2022)

IP performed using in HeLa cells in RIPA buffer using 5ug of ror2 antibody per 1ug/ml of protein lysate. pulldown performed using magnetic protein A beads (NEB). western blot probed with another ror2 specific antibody raised in mouse ( MABS1152 )

  • Applications: Immunoprecipitation
  • Primary Antibody Dilution: 5ug of protein used for IP
  • Cell Tissue Type: HeLa
ROR2 Antibody Immunoprecipitation validation (5ug of protein used for IP dilution) in HeLa (Cat no:25842-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...