ROS1 Polyclonal antibody

ROS1 Polyclonal Antibody for ELISA
Cat No. 26960-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

c ros 1, MCF3, Proto oncogene c Ros 1, ROS, ROS1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

26960-1-AP targets ROS1 in ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25722

Product name: Recombinant human ROS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 27-128 aa of NM_002944

Sequence: MTVLNSCLKSCVTNLGQQLDLGTPHNLSEPCIQGCHFWNSVDQKNCALKCRESCEVGCSSAEGAYEEEVLENADLPTAPFASSIGSHNMTLRWKSANFSGVK

Predict reactive species
Full Name c-ros oncogene 1 , receptor tyrosine kinase
Calculated Molecular Weight 264 kDa
GenBank Accession NumberNM_002944
Gene Symbol ROS1
Gene ID (NCBI) 6098
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08922
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ROS1, an orphan receptor tyrosine kinase of the insulin receptor family, was initially identified as a homolog of v-ros from the UR2 sarcoma virus (PMID: 3023956). Investigators have found that rearrangements of the ROS1 gene occur in many cancers. The first oncogenic fusion of ROS1, FIG-ROS1, was initially identified by research studies in glioblastoma (PMID: 12661006), and subsequent studies have found this fusion in cholangiocarcinoma, ovarian cancer and non-small cell lung cancer (NSCLC) (PMID: 21253578, 22163003, 22661537). Additional oncogenic ROS1 fusion proteins have been found in NSCLC (at a frequency of 1-2%), including FIG, CD74, SLC34A2 and SDC4, and the list is growing. CD74-ROS1 is the most frequently detected ROS1 fusion in this group of patients. With all of the known fusion genes, the ROS1 kinase domain is fully retained and the ROS1 junction point at the messenger RNA (mRNA) level invariably occurs at the 5' end of exons 32, 34, 35 or 36 (PMID: 27535289). The molecular mass of some ROS1 fusion proteins are detected as follows: FIG-ROS1 (110 kDa), SLC34A2-ROS1 (85/70/59 kDa), CD74-ROS1 (80 kDa), and SDC4-ROS1 (75 kDa). (PMID: 22661537, 22659450)

Loading...
||
New chat Able
正在加载,请稍候...