RP11-45B20.2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RP11-45B20.2 Polyclonal antibody, PBS Only (34185-1-PBS)

• 

  WB analysis using 34185-1-AP (same clone as 34185-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 34185-1-AP (RP11-45B20.2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 34185-1-PBS in a different storage buffer formulation.

RP11-45B20.2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 34185-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C1q/TNF-related protein 9B, C1QTNF9B, Complement C1q and tumor necrosis factor-related protein 9B, Complement C1q and tumor necrosis factor-related protein 9-like, CTRP9B

---

Product Information

34185-1-PBS targets RP11-45B20.2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag41415

  Product name: Recombinant human RP11-45B20.2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 197-333 aa of BC137004

  Sequence: LVLPKSAFTVGLTVLSKFPSSDVPIKFDKILYNEFNHYDTAVGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTRDAYVSSEDQASGSIVLQLKLGDEMWLQVTGGERFNGLFADEDDDTTFTGFLLFSSQ

• Full Name: collagen triple helix repeat-containing
• Observed Molecular Weight: 34-37 kDa
• GenBank Accession Number: BC137004
• Gene Symbol: RP11-45B20.2
• Gene ID (NCBI): 387911
• RRID: AB_3743168
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: B2RNN3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RP11-45B20.2(C1QTNF9B/CTRP9B) is a secreted protein with triple helix structure of collagen and C1q domain, belonging to CTRP family. It may participate in metabolic regulation by activating AMPK/AKT/MAPK signaling pathway, and it may be used as a potential prognostic marker in many cancers. The expression of this protein in retina also suggests that it may be related to eye diseases (such as high myopia). Its observed molecular weight is 34-37 kDa.