DPCD Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DPCD Polyclonal antibody (20936-1-AP)

DPCD Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20936-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

DPCD, Protein DPCD, RP11 529I10.4, RP11-529I10.4

• 

  WB analysis using 20936-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20936-1-AP (DPCD antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 20936-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 20936-1-AP (DPCD antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 20936-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20936-1-AP (DPCD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 20936-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20936-1-AP (DPCD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 20936-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart slide using 20936-1-AP (DPCD antibody at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 20936-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart slide using 20936-1-AP (DPCD antibody at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DPCD in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue, human testis tissue, rat testis tissue
• Positive IHC detected in: mouse testis tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20936-1-AP targets DPCD in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15029

  Product name: Recombinant human RP11-529I10.4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-203 aa of BC031695

  Sequence: MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKFSIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCKTQ

• Full Name: deleted in a mouse model of primary ciliary dyskinesia
• Calculated Molecular Weight: 203 aa, 23 kDa
• Observed Molecular Weight: 23-26 kDa
• GenBank Accession Number: BC031695
• Gene Symbol: DPCD
• Gene ID (NCBI): 25911
• RRID: AB_10734461
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BVM2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DPCD (for deleted in a mouse model of primary ciliary dyskinesia), is predicted to code for a protein of 23 kDa which remains a novel candidate gene for PCD (Primary ciliary dyskinesia).

Publications

What published studies show

The DPCD Polyclonal antibody (Cat# 20936-1-AP) has 3 total citations published in Cell Reports, Scientific Reports, and Cytoskeleton. The research fields span ciliogenesis and ciliary motility (DPCD's role in R2TP regulation and inner dynein arm defects causing hydrocephalus), as well as TDP-43 aggregation in protein expression studies. Applications cited include WB and IF.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Cell Rep; DPCD is a regulator of R2TP in ciliogenesis initiation through Akt signaling; Authors - Yu-Qian Mao
human	WB,IF	Sci Rep; TDP-43 aggregation mirrors TDP-43 knockdown, affecting the expression levels of a common set of proteins.; Authors - S Prpar Mihevc
	IF	Cytoskeleton (Hoboken); Dpcd Induces Hydrocephalus Because of Partial Defects in the Inner Dynein Arms, With Abnormal Ciliary Motility; Authors - Taiki Yamamoto