DPCD Polyclonal antibody

• 

  WB analysis using 20936-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20936-1-AP (DPCD antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 20936-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 20936-1-AP (DPCD antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 20936-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20936-1-AP (DPCD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 20936-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20936-1-AP (DPCD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 20936-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart slide using 20936-1-AP (DPCD antibody at dilution of 1:50.

• 

  IHC staining of human heart using 20936-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart slide using 20936-1-AP (DPCD antibody at dilution of 1:50.

DPCD Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20936-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

Synonyms

DPCD, Protein DPCD, RP11 529I10.4, RP11-529I10.4

---

Tested Applications

• Positive WB detected in: mouse testis tissue, human testis tissue, rat testis tissue
• Positive IHC detected in: mouse testis tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below

Product Information

20936-1-AP targets DPCD in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15029

  Product name: Recombinant human RP11-529I10.4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-203 aa of BC031695

  Sequence: MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKFSIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCKTQ

• Full Name: deleted in a mouse model of primary ciliary dyskinesia
• Calculated Molecular Weight: 203 aa, 23 kDa
• Observed Molecular Weight: 23-26 kDa
• GenBank Accession Number: BC031695
• Gene Symbol: DPCD
• Gene ID (NCBI): 25911
• RRID: AB_10734461
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BVM2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DPCD (for deleted in a mouse model of primary ciliary dyskinesia), is predicted to code for a protein of 23 kDa which remains a novel candidate gene for PCD (Primary ciliary dyskinesia).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Cell Rep; DPCD is a regulator of R2TP in ciliogenesis initiation through Akt signaling; Authors - Yu-Qian Mao
human	WB,IF	Sci Rep; TDP-43 aggregation mirrors TDP-43 knockdown, affecting the expression levels of a common set of proteins.; Authors - S Prpar Mihevc