RP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RP2 Polyclonal antibody, PBS Only (14151-1-PBS)

• 

  WB analysis using 14151-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14151-1-AP (RP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14151-1-AP (same clone as 14151-1-PBS)

  WB result of RP2 antibody (14151-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RP2 transfected HepG2 cells. This data was developed using the same antibody clone with 14151-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Y79 using 14151-1-AP (same clone as 14151-1-PBS)

  IP result of anti-RP2 (IP:14151-1-AP, 4ug; Detection:14151-1-AP 1:500) with Y79 cells lysate 2000ug. This data was developed using the same antibody clone with 14151-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 14151-1-AP (same clone as 14151-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14151-1-AP (RP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14151-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 14151-1-AP (same clone as 14151-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14151-1-AP (RP2 antibody) at dilution of 1:200 (under 0x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14151-1-PBS in a different storage buffer formulation.

RP2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 14151-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

DELXp11.3, KIAA0215, Protein XRP2, TBCCD2

---

Product Information

14151-1-PBS targets RP2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5332

  Product name: Recombinant human RP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC043348

  Sequence: MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI

• Full Name: retinitis pigmentosa 2 (X-linked recessive)
• Calculated Molecular Weight: 350 aa, 40 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC043348
• Gene Symbol: RP2
• Gene ID (NCBI): 6102
• RRID: AB_11182501
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75695
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.