RPAIN Polyclonal antibody

• 

  WB analysis of A2780 using 15220-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 15220-1-AP (RPAIN antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A375 using 15220-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 15220-1-AP (RPAIN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse ovary using 15220-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 15220-1-AP (RPAIN antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A375 using 15220-1-AP

  IP result of anti-RPAIN (IP:15220-1-AP, 4ug; Detection:15220-1-AP 1:300) with A375 cells lysate 2200 ug.

• 

  IHC staining of human ovary tumor using 15220-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 15220-1-AP (RPAIN antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary tumor using 15220-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 15220-1-AP (RPAIN antibody) at dilution of 1:50 (under 40x lens).

RPAIN Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 15220-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, IHC, ELISA

Synonyms

HRIP, RIP, RPA interacting protein, RPAIN

---

Tested Applications

• Positive WB detected in: A375 cells, mouse ovary tissue, A2780 cells
• Positive IP detected in: A375 cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15220-1-AP targets RPAIN in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7392

  Product name: Recombinant human RPAIN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-145 aa of BC004451

  Sequence: MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWNALQSVENCPEDLAQLEELIDMAVLEEIQQELINQEQSIISEYEKSLQFDEKCLSIMLAEWEANPLICPVCTNLLS

• Full Name: RPA interacting protein
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 30-45 kDa
• GenBank Accession Number: BC004451
• Gene Symbol: RPAIN
• Gene ID (NCBI): 84268
• RRID: AB_2180976
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86UA6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PAIN, also named as RIP, mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. RPAIN has many isoforms with MW 25-27 kDa, 12 kDa and 16-19 kDa. The publication with PMID: 16135809 reported the MW 30 and 45 kDa.