RPL12 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RPL12 Polyclonal antibody (14536-1-AP)

• Featured Product
• KD/KO Validated

RPL12 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14536-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

60S ribosomal protein L12, Large ribosomal subunit protein uL11, ribosomal protein L12

• 

  WB analysis using 14536-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14536-1-AP (RPL12 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14536-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14536-1-AP (RPL12 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14536-1-AP

  WB result of RPL12 antibody (14536-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RPL12 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 14536-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14536-1-AP (RPL12 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 14536-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 14536-1-AP (RPL12 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human endometrial cancer using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human endometrial cancer using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RPL12 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, Jurkat cells, HeLa cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human placenta tissue, human endometrial cancer tissue, mouse brain tissue, mouse stomach tissue, rat brain tissue, rat stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14536-1-AP targets RPL12 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, yeast, c.elegans
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6037

  Product name: Recombinant human RPL12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC050644

  Sequence: MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS

• Full Name: ribosomal protein L12
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC050644
• Gene Symbol: RPL12
• Gene ID (NCBI): 6136
• RRID: AB_2269722
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30050
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RPL12 Polyclonal antibody (Cat# 14536-1-AP) has 7 citations published in Nature Cell Biology, Molecular Cell, International Journal of Biological Macromolecules, Journal of Cell Biology, EMBO Reports, Scientific Reports, and Cell Reports. The associated research fields include ribophagy, mRNA translation and tumor progression, glioblastoma, cell proliferation and protein synthesis, rDNA transcription and ribosomal biogenesis, RNA G-quadruplex regulation, and mitotic spindle integrity.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
yeast,human,C.elegans	WB,IF	Nat Cell Biol; Rpl12 is a conserved ribophagy receptor; Authors - Yuting Chen ; KD Validated
		Mol Cell; Excess intracellular lactate represses mRNA translation and tumor progression through lactate-tRNA charging.; Authors - Xinyu Wang
human	WB	Int J Biol Macromol; Translational hub ribosomal protein S5 promotes glioblastoma progression by affecting translation patterns.; Authors - Lin Wang
human	WB	J Cell Biol; CDK1 couples proliferation with protein synthesis.; Authors - Katharina Haneke
mouse	WB	EMBO Rep; Kin17 promotes rDNA transcription, ribosomal biogenesis, and cortical lamination.; Authors - Wenbo Li
human	WB	Sci Rep; RNA G-quadruplex structures control ribosomal protein production; Authors - DhavalVarshney