RPL12 Polyclonal antibody

• 

  WB analysis using 14536-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14536-1-AP (RPL12 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 14536-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14536-1-AP (RPL12 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 14536-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 14536-1-AP (RPL12 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human endometrial cancer using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human endometrial cancer using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse stomach using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat stomach using 14536-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 14536-1-AP (RPL12 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RPL12 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14536-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

ribosomal protein L12, Large ribosomal subunit protein uL11, 60S ribosomal protein L12

---

Tested Applications

• Positive WB detected in: A549 cells, Jurkat cells, HeLa cells
• Positive IHC detected in: human placenta tissue, human endometrial cancer tissue, mouse brain tissue, mouse stomach tissue, rat brain tissue, rat stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IF: See 1 publications below

Product Information

14536-1-AP targets RPL12 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, yeast, c.elegans
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6037

  Product name: Recombinant human RPL12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC050644

  Sequence: MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS

• Full Name: ribosomal protein L12
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC050644
• Gene Symbol: RPL12
• Gene ID (NCBI): 6136
• RRID: AB_2269722
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30050
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Cell Biol; CDK1 couples proliferation with protein synthesis.; Authors - Katharina Haneke
human	WB	Sci Rep; RNA G-quadruplex structures control ribosomal protein production; Authors - DhavalVarshney
human,yeast,C.elegans	WB,IF	Nat Cell Biol; Rpl12 is a conserved ribophagy receptor; Authors - Yuting Chen ; KD Validated