RPL26L1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RPL26L1 Recombinant monoclonal antibody, PBS Only (87720-1-PBS)

• 

  WB analysis using 87720-1-RR (same clone as 87720-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87720-1-RR (RPL26L1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87720-1-PBS in a different storage buffer formulation.

RPL26L1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87720-1-PBS

Clone No.253255G12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

60S ribosomal protein L26-like 1, Large ribosomal subunit protein uL24-like 1, ribosomal protein L26 like 1, Ribosomal protein uL24-like, RPL26P1

---

Product Information

87720-1-PBS targets RPL26L1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9609

  Product name: Recombinant human RPL26L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-145 aa of BC017360

  Sequence: MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE

• Full Name: ribosomal protein L26-like 1
• Calculated Molecular Weight: 145 aa, 17 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC017360
• Gene Symbol: RPL26L1
• Gene ID (NCBI): 51121
• RRID: AB_3745716
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UNX3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RPL26L1, also named as RPL26P1, belongs to the universal ribosomal protein uL24 family. RPL26L1 shares high sequence similarity with ribosomal protein L26 and plays a role in protein synthesis (PMID: 31673979). The molecular mass of RPL26L1 is 17 kDa. Studies have shown that RPL26L1 is related to autism spectrum disorder and is one of the potential biomarkers of the neurodegenerative disease Friedreich's ataxia. In addition, RPL26L1 may be closely related with SLE development (PMID: 31889427).