CoraLite® Plus 488-conjugated RPL3 Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-82815

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 RPL3 antibody (CL488-82815, Clone: 3P18 ) at dilution of 1:200.

RPL3 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-82815

Clone No.3P18

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

ribosomal protein L3, OK/SW-cl.32, Large ribosomal subunit protein uL3, HIV-1 TAR RNA-binding protein B, 60S ribosomal protein L3

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82815 targets RPL3 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1436

  Product name: Recombinant human RPL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 153-403 aa of BC012786

  Sequence: MKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAKEEGA

• Full Name: ribosomal protein L3
• Calculated Molecular Weight: 46/27 kDa
• GenBank Accession Number: BC012786
• Gene Symbol: RPL3
• Gene ID (NCBI): 6122
• RRID: AB_3673083
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P39023
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3, also named as TARBP-B and MGC104284, belongs to the ribosomal protein L3P family. This protein is a component of the 60S subunit. It can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.