RPL5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85348-1-RR (same clone as 85348-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85348-1-RR (RPL5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85348-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 3T3-L1 using 85348-1-RR (same clone as 85348-1-PBS)

  3T3-L1 cells were subjected to SDS PAGE followed by western blot with 85348-1-RR (RPL5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85348-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 85348-1-RR (same clone as 85348-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RPL5 antibody (85348-1-RR, Clone: 242678D3 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85348-1-PBS in a different storage buffer formulation.

RPL5 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 85348-1-PBS

Clone No.242678D3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, monkey

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

60S ribosomal protein L5, DBA6, Large ribosomal subunit protein uL18, MSTP030, ribosomal protein L5

---

Product Information

85348-1-PBS targets RPL5 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, monkey samples.

• Tested Reactivity: human, mouse, monkey
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30837

  Product name: Recombinant human RPL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 178-297 aa of BC109370

  Sequence: KRFPGYDSESKEFNAEVHRKHIMGQNVADYMRCLMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAES

• Full Name: ribosomal protein L5
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC109370
• Gene Symbol: RPL5
• Gene ID (NCBI): 6125
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P46777
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RPL5 (Ribosomal Protein L5) is a crucial component of the 60S ribosomal subunit, playing a significant role in ribosome biogenesis and function. It is required for rRNA maturation and the formation of the 60S ribosomal subunits. Defects or mutations in RPL5 are associated with Diamond-Blackfan anemia (DBA), a congenital disorder characterized by red blood cell aplasia.(PMID: 28376382)