RPP40 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RPP40 Polyclonal antibody (11736-1-AP)

RPP40 Polyclonal Antibody for WB, ELISA

Cat No. 11736-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

RNase P subunit 1, RNaseP protein p40, RNASEP1, RPP40

• 

  WB analysis of HeLa using 11736-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11736-1-AP (RPP40 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RPP40 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, COLO 320 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11736-1-AP targets RPP40 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2341

  Product name: Recombinant human RPP40 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-244 aa of BC017871

  Sequence: MNTGPYYFVKNLPLHELITPEFISTFIKKGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKK

• Full Name: ribonuclease P/MRP 40kDa subunit
• Calculated Molecular Weight: 35 kDa, 41 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC017871
• Gene Symbol: RPP40
• Gene ID (NCBI): 10799
• RRID: AB_2182364
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75818
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

RPP40 Polyclonal antibody (Cat# 11736-1-AP) has a total of 4 citations appearing in Nature Communications, Nucleic Acids Research, Biochemical and Biophysical Research Communications, and bioRxiv. The associated research fields include RNase MRP biology, RNA binding specificity in metazoans, and hepatocellular carcinoma proliferation through mTOR/MYC signaling pathway activation.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nat Commun; Reversible proliferative arrest induced by rapid depletion of RNase MRP; Authors - Yuan Liu
		Nucleic Acids Res; Composition and RNA binding specificity of metazoan RNase MRP; Authors - Yuan Liu
		Biochem Biophys Res Commun; RPP40, a subunit of Ribonuclease P, facilitates hepatocellular carcinoma proliferation by activating the mTOR/MYC signaling.; Authors - Li-na Huang
human	WB	bioRxiv; Composition and RNA binding specificity of metazoan RNase MRP; Authors - Yuan Liu