RPP40 Polyclonal antibody

• 

  WB analysis of HeLa using 11736-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11736-1-AP (RPP40 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

RPP40 Polyclonal Antibody for WB, ELISA

Cat No. 11736-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

RNase P subunit 1, RNaseP protein p40, RNASEP1, RPP40

---

Tested Applications

• Positive WB detected in: HeLa cells, COLO 320 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

11736-1-AP targets RPP40 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2341

  Product name: Recombinant human RPP40 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-244 aa of BC017871

  Sequence: MNTGPYYFVKNLPLHELITPEFISTFIKKGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKK

• Full Name: ribonuclease P/MRP 40kDa subunit
• Calculated Molecular Weight: 35 kDa, 41 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC017871
• Gene Symbol: RPP40
• Gene ID (NCBI): 10799
• RRID: AB_2182364
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75818
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	bioRxiv; Composition and RNA binding specificity of metazoan RNase MRP; Authors - Yuan Liu