RPS15A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RPS15A Polyclonal antibody (14942-1-AP)

RPS15A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14942-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

40S ribosomal protein S15a, ribosomal protein S15a, RPS15A, S15a

• 

  WB analysis using 14942-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14942-1-AP (RPS15A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14942-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14942-1-AP (RPS15A antibody) at dilution of 1:50 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14942-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14942-1-AP (RPS15A antibody) at dilution of 1:50 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RPS15A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14942-1-AP targets RPS15A in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6655

  Product name: Recombinant human RPS15A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-130 aa of BC001697

  Sequence: MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRSDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHTGGKILGFFF

• Full Name: ribosomal protein S15a
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 13-15 kDa
• GenBank Accession Number: BC001697
• Gene Symbol: RPS15A
• Gene ID (NCBI): 6210
• RRID: AB_3085446
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62244
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RPS15A is a component of the small ribosomal subunit, it is required for proper erythropoiesis.

Publications

What published studies show

The RPS15A Polyclonal antibody (Cat# 14942-1-AP) has 1 citation. It appears in Cancer Medicine (2024), in a study investigating MCM8's role in promoting gastric cancer progression through RPS15A and its prognostic value. The research field is oncology, specifically gastric cancer biology. The antibody was used for WB and IHC applications in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Cancer Med; MCM8 promotes gastric cancer progression through RPS15A and predicts poor prognosis; Authors - Lixian Ding