RPS6KB2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RPS6KB2 Polyclonal antibody (26194-1-AP)

RPS6KB2 Polyclonal Antibody for WB, ELISA

Cat No. 26194-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

KLS, P70 beta, P70 beta 1, P70 beta 2, p70 ribosomal S6 kinase beta, p70 S6 kinase beta, p70 S6K 2, p70 S6K beta, p70 S6KB, p70(S6K) beta, P70S6K2, p70S6Kb, RPS6KB2, S6 kinase related kinase, S6K beta, S6K beta 2, S6K beta2, S6K2, SRK, STK14B

• 

  WB analysis of MCF-7 using 26194-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26194-1-AP (RPS6KB2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RPS6KB2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26194-1-AP targets RPS6KB2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23800

  Product name: Recombinant human RPS6KB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-51 aa of BC000094

  Sequence: MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELT

• Full Name: ribosomal protein S6 kinase, 70kDa, polypeptide 2
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC000094
• Gene Symbol: RPS6KB2
• Gene ID (NCBI): 6199
• RRID: AB_2880419
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBS0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RPS6KB2 Polyclonal antibody (Cat# 26194-1-AP) has 3 total citations. These appear in bioRxiv, eLife, and Molecular Therapy Nucleic Acids. The cited research spans oncology (lncRNA CyKILRb activating the PI3K/AKT axis in cancer), translational biology (eIF2A-mediated translational control in HeLa cells), and molecular therapy involving ceRNA mechanisms in tumor suppression. All citations used the antibody for Western blot applications in human samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	bioRxiv; The long non-coding RNA, CyKILRb, augments oncogenic phenotypes via induction of PIK3R2 and activation of the PI (3) K/AKT axis.; Authors - Xiujie Xie
human	WB	Elife; Human eIF2A has a minimal role in translation initiation and in uORF-mediated translational control in HeLa cells; Authors - Mykola Roiuk
		Mol Ther Nucleic Acids; The lncRNA, CyKILRb acts as a ceRNA for tumor suppressive microRNA to augment oncogenic phenotype via induction of PIK3R2/PI(3)K/AKT axis.; Authors - Xiujie Xie